PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_282_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family BES1
Protein Properties Length: 316aa    MW: 33844.9 Da    PI: 9.3536
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_282_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822219.38.7e-6861561150
                              DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskp 75 
                                         g+sgr ptwkErEnnkrRERrRRaiaaki++GLRaqGnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp
  cra_locus_282_iso_3_len_1751_ver_3   6 GSSGRLPTWKERENNKRRERRRRAIAAKIFSGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKGCKP 80 
                                         689************************************************************************ PP

                              DUF822  76 leeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvss 148
                                         +  +ea+++s+++s++sslq s+ ss+++spv+sy+asp+ss  psp++ d + +  +  + +lp+l++l+++++
  cra_locus_282_iso_3_len_1751_ver_3  81 P-PMEAGVASTNISTCSSLQPSPLSSSFPSPVPSYHASPSSSLCPSPTRGDGNGNGGNpsSYILPFLRNLASIPN 154
                                         *.*************************************************9988877789999*****999988 PP

                              DUF822 149 sl 150
                                         sl
  cra_locus_282_iso_3_len_1751_ver_3 155 SL 156
                                         76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.9E-647149IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009741Biological Processresponse to brassinosteroid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MTAAGGSSGR LPTWKERENN KRRERRRRAI AAKIFSGLRA QGNYKLPKHC DNNEVLKALC  60
AEAGWIVEED GTTYRKGCKP PPMEAGVAST NISTCSSLQP SPLSSSFPSP VPSYHASPSS  120
SLCPSPTRGD GNGNGGNPSS YILPFLRNLA SIPNSLPPLR ISNSAPVTPP LSSPTRGSKR  180
KPEWEPFSNV QLPSFPHNLF AASAPSSPTR RRHLKPATIP ECDESDVSTV DSARWVSFQT  240
TPAAPSSPTF NLIKPASKQN LPVDGCSQFA WGVAPQRGCG SEFAFESGTI KAWEGERAHE  300
IGVDDLELTL GSGKAH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349751.11e-140PREDICTED: BES1/BZR1 homolog protein 2-like
SwissprotQ94A431e-103BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLA0A068U2N41e-141A0A068U2N4_COFCA; Uncharacterized protein
STRINGVIT_04s0023g01250.t011e-134(Vitis vinifera)